PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT00513
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 305aa    MW: 32522.7 Da    PI: 7.8504
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT00513genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53e-13144188347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ l++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qk+
         EMT00513 144 PWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQKF 188
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.105.7E-4323IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129414.156134193IPR017930Myb domain
SMARTSM007173.9E-9141191IPR001005SANT/Myb domain
SuperFamilySSF466895.68E-16141194IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-16142192IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-9143184IPR009057Homeodomain-like
PfamPF002491.5E-10144187IPR001005SANT/Myb domain
CDDcd001672.53E-9144189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MARKCSHCGN YGHNSRTCSS TGKQGEIMLC EGGGGSSSGS GLRLFGVQVH VAAGRSTGLG  60
ASMRKSYSMD CLQLAVAPSS IVSPSSSSSS SVLLSIDEGL ERASNGYLSD GPHGRLVQER  120
KKVVDELWPP ELNGPSVNMS TGVPWSEEEH RLFLVGLEKL GKGDWRGISR SYVTTRTPTQ  180
VASHAQKFFL RQSSMGKKKR RSSLFDMVPI CENGIRVSEP LTNNGEGAST SLPRYKSPDM  240
ASIDLNSTQE DDMAMAGVPL LSESPRAPFP AVLMEQPPHG HGHGHHCSPL DLELGMSLSP  300
PSIGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196200KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3591960.0AK359196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1091L03.
GenBankAK3705260.0AK370526.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2112B05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569313.11e-129PREDICTED: uncharacterized protein LOC100839820
TrEMBLR7VYV90.0R7VYV9_AEGTA; Myb-like protein J
STRINGMLOC_7981.11e-153(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.19e-45MYB_related family protein